-
Notifications
You must be signed in to change notification settings - Fork 0
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
add template and dataset creation function
- Loading branch information
Showing
7 changed files
with
164 additions
and
2 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,10 @@ | ||
cff-version: 1.2.0 | ||
message: "In lieu of an associated paper, please cit this dataset as below" | ||
authors: | ||
- family-names: Englander | ||
given-names: Walter | ||
orcid: https://orcid.org/0000-0000-0000-0000 | ||
title: "My dataset" | ||
version: 1.0.0 | ||
doi: 10.5281/zenodo.1234 | ||
date-released: 1970-01-01 |
Empty file.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,71 @@ | ||
data_files: | ||
data_1: | ||
filename: data\data_file.csv | ||
format: DynamX | ||
data_2: | ||
filename: data\data_FD.csv | ||
format: DynamX | ||
|
||
metadata: # global metadata equal for all protein states | ||
pH: 7.5 | ||
protein: | ||
uniprot: P10408 | ||
model: # Optional protein model information | ||
database: pdb | ||
entry: 2vda | ||
|
||
states: | ||
SecB_ADP_glucose: # Short human-readable identifier for this protein HDX state | ||
peptides: # Dictionary of peptides defined for this HDX state (typically experiment, FD_control, ND_control) | ||
experiment: | ||
data_file: data_1 # Reference to data files defined above | ||
state: protein_state # which protein state to select from data file table | ||
exposure: # Exposure value(s) to select from data file table | ||
values: | ||
- 10 | ||
- 30 | ||
- 60 | ||
- 300 | ||
- 1200 | ||
unit: s | ||
FD_control: | ||
data_file: data_FD | ||
state: SecB WT apo | ||
exposure: | ||
value: 0.167 | ||
unit: min | ||
description: # Optional additional experimental details per peptide set. | ||
method: GdHCl and heating | ||
DOI: ... | ||
metadata: | ||
pH: 7.5 # pH_read, uncorrected | ||
d_percentage: 90. # Percentage deuterium in exchange buffer | ||
temperature: # Temperature of the exchange buffer and unit | ||
value: 30. | ||
unit: Celsius | ||
sequence: MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTV # FASTA Sequence including deletions and mutations, tags | ||
n_term: 1 # Residue number of the N terminal residue (can be negative) | ||
c_term: 155 # Residue number of the C terminal residue | ||
concentration: 20e-6 # Concentration of the protein during H/D labelling, in M | ||
oligomeric_state: 1 # Oligomeric state of the protein during H/D labelling | ||
ligand: # Section for added ligand(s) during H/D labelling ( | ||
- name: ATP | ||
concentration: 1e-3 | ||
ChemSpider: 5800 | ||
- name: glucose | ||
concentration: 2e-5 | ||
InChI: "1S/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6?/m1/s1" | ||
chaotrope: null | ||
mutations: | ||
- A123B | ||
- H484Q | ||
deletions: | ||
- [1, 20] # Deletion of residues 1 up to and including 20 | ||
protein_complex: # Description of the protein complex this protein is in | ||
- name: SecY # human readable name | ||
UniProt: P0AGA2 | ||
stoichiometry: 1 # Number of this protein per POI | ||
- name: SecB | ||
UniProt: P0AG86 | ||
stoichiometry: 2 | ||
|
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,25 @@ | ||
data: | ||
protein: SecB | ||
RCSB_entry: null | ||
identifier: null | ||
description: | ||
|
||
#citation.cff author format? | ||
authors: | ||
- name: Kaj Ulrik Linderstrøm-Lang | ||
email: null | ||
ORCID: null | ||
affiliation: null | ||
|
||
# List of publications where the datasets are published | ||
publications: | ||
- title: null | ||
DOI: null | ||
URL: null | ||
|
||
# Repositories where the data is also published or where the raw data is deposited | ||
repositories: | ||
- repository: Zenodo | ||
DOI: null | ||
ULR: null | ||
comments: Raw data |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters